PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v0392190.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 667aa    MW: 75810.1 Da    PI: 5.0155
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v0392190.4genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.11.4e-5661331128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtdeelv++yLk+k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratksgyWkatgkd++v
  Lj6g3v0392190.4   6 LPPGFRFHPTDEELVSYYLKRKINGRKIEL-EIIPEVDLYKCEPWDLPgKsLLPGKDLEWYFFSPRDRKYPNGSRTNRATKSGYWKATGKDRKV 98 
                      79****************************.99***************6434445667************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +s +++++g+kktLv+y+grap+g++t Wvmheyrl
  Lj6g3v0392190.4  99 HS-QSRAIGMKKTLVYYRGRAPHGSRTGWVMHEYRL 133
                      **.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-644158IPR003441NAC domain
PROSITE profilePS5100562.0156158IPR003441NAC domain
PfamPF023651.5E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV SYYLKRKING RKIELEIIPE VDLYKCEPWD LPGKSLLPGK  60
DLEWYFFSPR DRKYPNGSRT NRATKSGYWK ATGKDRKVHS QSRAIGMKKT LVYYRGRAPH  120
GSRTGWVMHE YRLDERECET ATASGLQDAY ALCRVFKKST VIAPKVGEQY VNVTRHANQM  180
TSEQSSSIEL YSEGRGEVLE STNYLMPWDT CSTQNVNGAP ASYSSFPNSG TRDNGMWSQF  240
SSDDLLNLPT SSSSFPNYGA IPYPPSKVDI ALECARMQHR FTMPPLEVED FPQVGNSELK  300
MMTQASGSMS GSKRETDILQ EILSVAHVSQ ELINQSSYSQ ALWGSNSDNY APHENDFTFM  360
VDTNNYNHMN DMNSLRYVDK AWEDPNARSI DIIGDLHDDF KADQRMVENL RWVGMSSKDF  420
EKSFMEEQKV VPIEDISSFQ TIREENEVQA ESEQQNSNKE LNDTDIDNFS LEFINDDDPN  480
VNFIDDGNID YSNSSSFEVV EETKVSHGMF VSTGQIAETF FHQIAPSQTI KVQLNPVMTN  540
KHSIENAETM VINQEYSLFW KFKDYALGKL IKPSKTTASA LLYIFAILLM HGGYLKEQVE  600
DWKPDLVDVK MRSQSAEKIT WYEEEKIGIV GIKCGKGFSV VLKKIGIFLT ISFALCTVWA  660
NHITVSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-56215811168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003600640.10.0NAC transcription factor-like protein
TrEMBLA0A0B2QRC90.0A0A0B2QRC9_GLYSO; NAC domain-containing protein 74
STRINGGLYMA11G33210.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-163NAC domain containing protein 28